Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IKBKG Rabbit Polyclonal Antibody (HRP)

IKBKG Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IP, IP1, IP2, FIP3, IKKG, IPD2, NEMO, FIP-3, Fip3p, IMD33, AMCBX1, EDAID1, IKKAP1, ZC2HC9, IKK-gamma

UniProt

Q9Y6K9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IKBKG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPET

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003630

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LOC110384692 activation kit by CRISPRa
GA119977 1 Kit

Human LOC110384692 activation kit by CRISPRa

Sign In for Pricing
View Details
MIOX Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D1]
TA501476AM 100 µL

MIOX Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D1]

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/2894R), CF405S conjugate, 0.1mg/mL
BNC042894-500 1x 500 µL

Spectrin beta III (SPTBN2) (SPTBN2/2894R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (MLP/842), CF405S conjugate, 0.1mg/mL
BNC040842-500 1x 500 µL

MUC2 (MLP/842), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BAD Human Gene Knockout Kit (CRISPR)
KN400634 1 Kit

BAD Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
BNC400352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details