Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IKBKG Rabbit Polyclonal Antibody (HRP)

IKBKG Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IP, IP1, IP2, FIP3, IKKG, IPD2, NEMO, FIP-3, Fip3p, IMD33, AMCBX1, EDAID1, IKKAP1, ZC2HC9, IKK-gamma

UniProt

Q9Y6K9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IKBKG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPET

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003630

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orbi-Shaker™ CO2-MP with remote controller and platform for 6 microplates, 230V
BT4500-E 1 Each

Orbi-Shaker™ CO2-MP with remote controller and platform for 6 microplates, 230V

Sign In for Pricing
View Details
IF 2(Mt) (MTIF2) (NM_002453) Human Over-expression Lysate
LC419315 20 µg

IF 2(Mt) (MTIF2) (NM_002453) Human Over-expression Lysate

Sign In for Pricing
View Details
TECPR1 (C-term) Rabbit Polyclonal Antibody
AP17783PU-N 400 µL

TECPR1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF621 (NM_001098414) Human Over-expression Lysate
LC420578 20 µg

ZNF621 (NM_001098414) Human Over-expression Lysate

Sign In for Pricing
View Details
QuantiChrom™ Zinc Assay Kit
DIZN-250 250 Tests

QuantiChrom™ Zinc Assay Kit

Sign In for Pricing
View Details
Mesothelin (Mesothelial Marker) (MSLN/2131), Biotin conjugate, 0.1mg/mL
BNCB2131-100 1x 100 µL

Mesothelin (Mesothelial Marker) (MSLN/2131), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details