Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLIS2 Rabbit Polyclonal Antibody (HRP)

GLIS2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NKL, NPHP7

UniProt

Q9BZE0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GLIS2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQF

Field of Research

Neuroscience

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115964

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tumor necrosis factor receptor superfamily member 14 ELISA Kit
MBS765585-01 48 Well

Human Tumor necrosis factor receptor superfamily member 14 ELISA Kit

Sign In for Pricing
View Details
Human Tumor necrosis factor receptor superfamily member 14 ELISA Kit
MBS765585-02 96 Well

Human Tumor necrosis factor receptor superfamily member 14 ELISA Kit

Sign In for Pricing
View Details
Human Tumor necrosis factor receptor superfamily member 14 ELISA Kit
MBS765585-03 5x 96 Well

Human Tumor necrosis factor receptor superfamily member 14 ELISA Kit

Sign In for Pricing
View Details
Human Tumor necrosis factor receptor superfamily member 14 ELISA Kit
MBS765585-04 10x 96 Well

Human Tumor necrosis factor receptor superfamily member 14 ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Ankrd1 shRNA (UAS) - Lentiviral mouse Ankrd1 shRNA (UAS, RFP) (25)
GTR15226427 1 Vial

Lentiviral mouse Ankrd1 shRNA (UAS) - Lentiviral mouse Ankrd1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
QuickDetect™ Remnant lipoprotein cholesterol (RLP-c) (Mouse) ELISA Kit
K4439-100 100 Assays

QuickDetect™ Remnant lipoprotein cholesterol (RLP-c) (Mouse) ELISA Kit

Sign In for Pricing
View Details