Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zbtb37 Rabbit Polyclonal Antibody (HRP)

Zbtb37 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

D430004I08Rik

UniProt

Q8C3U9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGHGSIGQESYTLGSSGAKV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_775600

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QPCR Kit DNA Simian virus 40
MOL8346 1 Each

QPCR Kit DNA Simian virus 40

Sign In for Pricing
View Details
BIRC2 Polyclonal Antibody
RA31289-01 50 µL

BIRC2 Polyclonal Antibody

Sign In for Pricing
View Details
BIRC2 Polyclonal Antibody
RA31289-02 100 µL

BIRC2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human DNA-binding protein inhibitor ID-2 polyclonal Antibody, Biotin conjugated
MBS1488536-01 0.05 mg

Rabbit anti-human DNA-binding protein inhibitor ID-2 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human DNA-binding protein inhibitor ID-2 polyclonal Antibody, Biotin conjugated
MBS1488536-02 0.1 mg

Rabbit anti-human DNA-binding protein inhibitor ID-2 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human DNA-binding protein inhibitor ID-2 polyclonal Antibody, Biotin conjugated
MBS1488536-03 5x 0.1 mg

Rabbit anti-human DNA-binding protein inhibitor ID-2 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details