Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZMAT1 Rabbit Polyclonal Antibody (HRP)

ZMAT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZMAT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EASQTYQRPYHISPVESQLPQWLPTHSKRTYDSFQDELEDYIKVQKARGL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115817

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Mouse CD1d Flow Cytometry Monoclonal Clone 19G11 AF488 Ready To Use 100 Tests
IRTAMSCD1D19G11CAF488100 100 Tests

Anti Mouse CD1d Flow Cytometry Monoclonal Clone 19G11 AF488 Ready To Use 100 Tests

Sign In for Pricing
View Details
RFX4 Rabbit Polyclonal Antibody (HRP)
orb2137394 100 µL

RFX4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
AdmiRa-hsa-miR-365b-5p Virus
mh1785 250 µL

AdmiRa-hsa-miR-365b-5p Virus

Sign In for Pricing
View Details
KRT34 Antibody
orb864050 2 mg

KRT34 Antibody

Sign In for Pricing
View Details
Human MT-CO1 ELISA Kit
orb563771-01 48 Tests

Human MT-CO1 ELISA Kit

Sign In for Pricing
View Details
Human MT-CO1 ELISA Kit
orb563771-02 96 Tests

Human MT-CO1 ELISA Kit

Sign In for Pricing
View Details