Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF512 Rabbit Polyclonal Antibody (Biotin)

ZNF512 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q96ME7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF512

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QLRSLAGMKYHVMANHNSLPILKAGDEIDEPSERERLRTVLKRLGKLRCM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115810

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4EBP1 Antibody (Center) Blocking peptide
MBS9219280-01 0.5 mg

EIF4EBP1 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
EIF4EBP1 Antibody (Center) Blocking peptide
MBS9219280-02 5x 0.5 mg

EIF4EBP1 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
FA45A rabbit pAb
UB-GEN-11558 100 µL

FA45A rabbit pAb

Sign In for Pricing
View Details
ZBTB25, CT (ZBTB25, C14orf51, KUP, ZNF46, Zinc finger and BTB domain-containing protein 25, Zinc finger protein 46, Zinc finger protein KUP) (APC) discontinued
043995-APC 200 µL

ZBTB25, CT (ZBTB25, C14orf51, KUP, ZNF46, Zinc finger and BTB domain-containing protein 25, Zinc finger protein 46, Zinc finger protein KUP) (APC) discontinued

Sign In for Pricing
View Details
E2F6 Rabbit Polyclonal Antibody
orb13380-01 50 μL

E2F6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
E2F6 Rabbit Polyclonal Antibody
orb13380-02 100 µL

E2F6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details