Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF414 Rabbit Polyclonal Antibody (HRP)

ZNF414 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZFP414

UniProt

A8MY94

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZNF414

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LPYLNPAPFGLSPPRLRPFLAAAPGPPASSAAVWKKSQGAGSSPRRPQGG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115746

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC10 (DnaJ Homolog Subfamily C Member 10, ER-resident Protein ERdj5, Macrothioredoxin, MTHr, ERDJ5, UNQ495/PRO1012, DKFZp434J1813, MGC104194) (MaxLight 650)
125942-ML650 100 µL

DNAJC10 (DnaJ Homolog Subfamily C Member 10, ER-resident Protein ERdj5, Macrothioredoxin, MTHr, ERDJ5, UNQ495/PRO1012, DKFZp434J1813, MGC104194) (MaxLight 650)

Sign In for Pricing
View Details
Anti-T7 Tag Mouse Monoclonal Antibody (6D4)
MBS9719155-01 0.05 mL

Anti-T7 Tag Mouse Monoclonal Antibody (6D4)

Sign In for Pricing
View Details
Anti-T7 Tag Mouse Monoclonal Antibody (6D4)
MBS9719155-02 0.2 mL

Anti-T7 Tag Mouse Monoclonal Antibody (6D4)

Sign In for Pricing
View Details
Anti-T7 Tag Mouse Monoclonal Antibody (6D4)
MBS9719155-03 5x 0.2 mL

Anti-T7 Tag Mouse Monoclonal Antibody (6D4)

Sign In for Pricing
View Details
NANOS1, NT (Nanos homolog 1, NOS-1, EC_Rep1a, NOS1) (FITC) discontinued
038787-FITC 200 µL

NANOS1, NT (Nanos homolog 1, NOS-1, EC_Rep1a, NOS1) (FITC) discontinued

Sign In for Pricing
View Details
Mouse Zinc finger CCHC domain-containing protein 14 (ZCCHC14) ELISA Kit
MBS283387-01 48 Tests

Mouse Zinc finger CCHC domain-containing protein 14 (ZCCHC14) ELISA Kit

Sign In for Pricing
View Details