Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF541 Rabbit Polyclonal Antibody (Biotin)

ZNF541 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9H0D2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF541

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AGPPADPSKSKLTIFSRIQGGNIYRLPHPVKEENVAGRGNQQNGSPTDWT

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

CAD38720

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CD200/OX2 Antibody (002) [FITC]
NBP2-90396F 0.1 mL

Rabbit Monoclonal CD200/OX2 Antibody (002) [FITC]

Sign In for Pricing
View Details
Mouse Marf1 Pre-designed siRNA Set A
SI108177A 1 Each

Mouse Marf1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-Laminin/Lamc1/Lamc2/Lamc3 Antibody Picoband® Fluoro488 Conjugated
PB9142-Fluoro488 100 µg/Vial

Anti-Laminin/Lamc1/Lamc2/Lamc3 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Recombinant Brucella Suis BSUIS_B0593 Protein (aa 1-237)
VAng-Lsx5614-500gEcoli 500 µg (E. coli)

Recombinant Brucella Suis BSUIS_B0593 Protein (aa 1-237)

Sign In for Pricing
View Details
Rabbit Monoclonal L1CAM Antibody (L1CAM/9267R) [Allophycocyanin]
NBP3-24129APC 0.1 mL

Rabbit Monoclonal L1CAM Antibody (L1CAM/9267R) [Allophycocyanin]

Sign In for Pricing
View Details
Rabbit Polyclonal STEAP1 Antibody [CoraFluor 1]
NBP1-76821CL1 0.1 mL

Rabbit Polyclonal STEAP1 Antibody [CoraFluor 1]

Sign In for Pricing
View Details