Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L3MBTL2 Rabbit Polyclonal Antibody (FITC)

L3MBTL2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L3MBT, H-l (3) mbt-l

UniProt

Q969R5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human L3MBTL2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EYDQWVDCESPDIYPVGWCELTGYQLQPPVAAEPATPLKAKEATKKKKKQ

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_113676

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFI27 Antibody
orb1560904-01 50 µL

IFI27 Antibody

Sign In for Pricing
View Details
IFI27 Antibody
orb1560904-02 100 µL

IFI27 Antibody

Sign In for Pricing
View Details
IFI27 Antibody
orb1560904-03 200 µL

IFI27 Antibody

Sign In for Pricing
View Details
Adhesion G Protein-Coupled Receptor A2 (ADGRA2) Antibody
abx325673-01 50 µg

Adhesion G Protein-Coupled Receptor A2 (ADGRA2) Antibody

Sign In for Pricing
View Details
Adhesion G Protein-Coupled Receptor A2 (ADGRA2) Antibody
abx325673-02 100 µg

Adhesion G Protein-Coupled Receptor A2 (ADGRA2) Antibody

Sign In for Pricing
View Details
Nanog, Recombinant, Human, aa1-154, His-Tag (Early Embryo Specific Expression NK Family Gene, Embryonic Stem Cell Specific Homeobox Protein, ENK, FLJ12581, FLJ40451, Homeobox Transcription Factor Nanog, Nanog Homeobox)
N0019-02C 50 µg

Nanog, Recombinant, Human, aa1-154, His-Tag (Early Embryo Specific Expression NK Family Gene, Embryonic Stem Cell Specific Homeobox Protein, ENK, FLJ12581, FLJ40451, Homeobox Transcription Factor Nanog, Nanog Homeobox)

Sign In for Pricing
View Details