Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFAP2D Rabbit Polyclonal Antibody (HRP)

TFAP2D Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TFAP2BL1, AP-2delta

UniProt

Q7Z6R9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TFAP2D

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LGSSRPTPILDLDIQRHLTHFSLITHGFGTPAICAALSTFQTVLSEMLNY

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_758438

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSD95 (DLG4) Human Over-expression Lysate
orb1344504 100 µg

PSD95 (DLG4) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-CD3 Reference Antibody (visilizumab)
MBS9247109-01 0.1 mg

Anti-CD3 Reference Antibody (visilizumab)

Sign In for Pricing
View Details
Anti-CD3 Reference Antibody (visilizumab)
MBS9247109-02 5x 0.1 mg

Anti-CD3 Reference Antibody (visilizumab)

Sign In for Pricing
View Details
APLP2 Rabbit Polyclonal Antibody (Fluoro647)
orb3114871 100 µg

APLP2 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Stanniocalcin-2, Recombinant, Mouse, aa25-296
586401-01 20 µg

Stanniocalcin-2, Recombinant, Mouse, aa25-296

Sign In for Pricing
View Details
Stanniocalcin-2, Recombinant, Mouse, aa25-296
586401-02 100 µg

Stanniocalcin-2, Recombinant, Mouse, aa25-296

Sign In for Pricing
View Details