Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFAP2D Rabbit Polyclonal Antibody (Biotin)

TFAP2D Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TFAP2BL1, AP-2delta

UniProt

Q7Z6R9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TFAP2D

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LGSSRPTPILDLDIQRHLTHFSLITHGFGTPAICAALSTFQTVLSEMLNY

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_758438

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DSG3 Protein (N-His, Mus musculus (Mouse) )
P503360 100 µg

DSG3 Protein (N-His, Mus musculus (Mouse) )

Sign In for Pricing
View Details
SMPD4 (NM_001171083) Human Tagged ORF Clone Lentiviral Particle
RC230482L3V 200 µL

SMPD4 (NM_001171083) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Psma2 3'UTR Luciferase Stable Cell Line
TU117157 1.0 mL

Psma2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
USP18 (Ubiquitin Specific Peptidase 18, Ubl Carboxyl-terminal Hydrolase 18, 43kD ISG15-specific Protease, ISG43, hUBP43, ISG15-specific-processing Protease, Ubl Thioesterase 18, UBP43) (PE)
MBS6398193-01 0.1 mL

USP18 (Ubiquitin Specific Peptidase 18, Ubl Carboxyl-terminal Hydrolase 18, 43kD ISG15-specific Protease, ISG43, hUBP43, ISG15-specific-processing Protease, Ubl Thioesterase 18, UBP43) (PE)

Sign In for Pricing
View Details
USP18 (Ubiquitin Specific Peptidase 18, Ubl Carboxyl-terminal Hydrolase 18, 43kD ISG15-specific Protease, ISG43, hUBP43, ISG15-specific-processing Protease, Ubl Thioesterase 18, UBP43) (PE)
MBS6398193-02 5x 0.1 mL

USP18 (Ubiquitin Specific Peptidase 18, Ubl Carboxyl-terminal Hydrolase 18, 43kD ISG15-specific Protease, ISG43, hUBP43, ISG15-specific-processing Protease, Ubl Thioesterase 18, UBP43) (PE)

Sign In for Pricing
View Details
ELISA Kit FOR Corrinoid adenosyltransferase
E16472h 96 Tests

ELISA Kit FOR Corrinoid adenosyltransferase

Sign In for Pricing
View Details