Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scrt1 Rabbit Polyclonal Antibody (Biotin)

Scrt1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

D4A919

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Scrt1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MPRSFLVKKVKLDTFSSADLDSSYGRARSDLGVRLQDKGYLSDYVGPASV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001124042

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAXIP1 Rabbit Polyclonal Antibody
MBS9467707-01 0.05 mL

PAXIP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAXIP1 Rabbit Polyclonal Antibody
MBS9467707-02 0.1 mL

PAXIP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAXIP1 Rabbit Polyclonal Antibody
MBS9467707-03 5x 0.1 mL

PAXIP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ITGAE (Integrin alpha-E, HML-1 Antigen, Integrin alpha-IEL, Mucosal Lymphocyte 1 Antigen, CD103, CD103, Integrin alpha-E Heavy Chain)
321182-01 50 µL

ITGAE (Integrin alpha-E, HML-1 Antigen, Integrin alpha-IEL, Mucosal Lymphocyte 1 Antigen, CD103, CD103, Integrin alpha-E Heavy Chain)

Sign In for Pricing
View Details
ITGAE (Integrin alpha-E, HML-1 Antigen, Integrin alpha-IEL, Mucosal Lymphocyte 1 Antigen, CD103, CD103, Integrin alpha-E Heavy Chain)
321182-02 100 µL

ITGAE (Integrin alpha-E, HML-1 Antigen, Integrin alpha-IEL, Mucosal Lymphocyte 1 Antigen, CD103, CD103, Integrin alpha-E Heavy Chain)

Sign In for Pricing
View Details
Human Leptin Receptor HEK293 Overexpression Lysate
MBS8113704-01 0.3 mg

Human Leptin Receptor HEK293 Overexpression Lysate

Sign In for Pricing
View Details