Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK8 Rabbit Polyclonal Antibody (HRP)

CDK8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1560888

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1560888

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001102531

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EIF3B Antibody Picoband®, PE Conjugate
A04318-1-PE 100 µg/Vial

Anti-EIF3B Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
Rat Motile sperm domain-containing protein 2 (MOSPD2) ELISA Kit
MBS2803392-01 48 Tests

Rat Motile sperm domain-containing protein 2 (MOSPD2) ELISA Kit

Sign In for Pricing
View Details
Rat Motile sperm domain-containing protein 2 (MOSPD2) ELISA Kit
MBS2803392-02 96 Tests

Rat Motile sperm domain-containing protein 2 (MOSPD2) ELISA Kit

Sign In for Pricing
View Details
Rat Motile sperm domain-containing protein 2 (MOSPD2) ELISA Kit
MBS2803392-03 5x 96 Tests

Rat Motile sperm domain-containing protein 2 (MOSPD2) ELISA Kit

Sign In for Pricing
View Details
Rat Motile sperm domain-containing protein 2 (MOSPD2) ELISA Kit
MBS2803392-04 10x 96 Tests

Rat Motile sperm domain-containing protein 2 (MOSPD2) ELISA Kit

Sign In for Pricing
View Details
4-Hydroxy Norephedrine
CS-O-59568 1 Each

4-Hydroxy Norephedrine

Sign In for Pricing
View Details