Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK8 Rabbit Polyclonal Antibody (Biotin)

CDK8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RGD1560888

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1560888

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001102531

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPGDS Rabbit Polyclonal Antibody
MBS9514877-01 0.05 mL

HPGDS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HPGDS Rabbit Polyclonal Antibody
MBS9514877-02 0.1 mL

HPGDS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HPGDS Rabbit Polyclonal Antibody
MBS9514877-03 5x 0.1 mL

HPGDS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BTN2A2 (NM_001197238) Human Tagged ORF Clone
RG230807 10 µg

BTN2A2 (NM_001197238) Human Tagged ORF Clone

Sign In for Pricing
View Details
Corey PG-Lactone Diol
sc-223900 1 g

Corey PG-Lactone Diol

Sign In for Pricing
View Details
Human CD3 (HIT3b) Monoclonal Antibody, AbBy Fluor™ 350 Conjugated
bsm-30092M-BF350 100 µL

Human CD3 (HIT3b) Monoclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details