Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccna2 Rabbit Polyclonal Antibody (FITC)

Ccna2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MGC156527, Ccna2

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPET

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_446154

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Oviduct-Specific Glycoprotein 1 (OVGP1) ELISA Kit
MBS9343414-01 48 Well

Monkey Oviduct-Specific Glycoprotein 1 (OVGP1) ELISA Kit

Sign In for Pricing
View Details
Monkey Oviduct-Specific Glycoprotein 1 (OVGP1) ELISA Kit
MBS9343414-02 96 Well

Monkey Oviduct-Specific Glycoprotein 1 (OVGP1) ELISA Kit

Sign In for Pricing
View Details
Monkey Oviduct-Specific Glycoprotein 1 (OVGP1) ELISA Kit
MBS9343414-03 5x 96 Well

Monkey Oviduct-Specific Glycoprotein 1 (OVGP1) ELISA Kit

Sign In for Pricing
View Details
Monkey Oviduct-Specific Glycoprotein 1 (OVGP1) ELISA Kit
MBS9343414-04 10x 96 Well

Monkey Oviduct-Specific Glycoprotein 1 (OVGP1) ELISA Kit

Sign In for Pricing
View Details
DHX8 Antibody - N-terminal region : Biotin (ARP36380_P050-Biotin)
ARP36380_P050-Biotin 100 µL

DHX8 Antibody - N-terminal region : Biotin (ARP36380_P050-Biotin)

Sign In for Pricing
View Details
PPFIA2 siRNA (Human)
MBS8234911-01 15 nmol

PPFIA2 siRNA (Human)

Sign In for Pricing
View Details