Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP4 Rabbit Polyclonal Antibody (Biotin)

FKBP4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HBI, p52, Hsp56, FKBP51, FKBP52, FKBP59, PPIase

UniProt

P30416

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FKBP4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

IHC, WB

NCBI Accession Number

NP_002005

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CORO1A Conjugated Antibody
C33746 100 µL

CORO1A Conjugated Antibody

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Epithelial Neutrophil Activating Peptide 78 (ENA78)
MBS2048830-01 0.1 mL

FITC-Linked Polyclonal Antibody to Epithelial Neutrophil Activating Peptide 78 (ENA78)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Epithelial Neutrophil Activating Peptide 78 (ENA78)
MBS2048830-02 0.2 mL

FITC-Linked Polyclonal Antibody to Epithelial Neutrophil Activating Peptide 78 (ENA78)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Epithelial Neutrophil Activating Peptide 78 (ENA78)
MBS2048830-03 0.5 mL

FITC-Linked Polyclonal Antibody to Epithelial Neutrophil Activating Peptide 78 (ENA78)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Epithelial Neutrophil Activating Peptide 78 (ENA78)
MBS2048830-04 1 mL

FITC-Linked Polyclonal Antibody to Epithelial Neutrophil Activating Peptide 78 (ENA78)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Epithelial Neutrophil Activating Peptide 78 (ENA78)
MBS2048830-05 5 mL

FITC-Linked Polyclonal Antibody to Epithelial Neutrophil Activating Peptide 78 (ENA78)

Sign In for Pricing
View Details