Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAP1 Rabbit Polyclonal Antibody (FITC)

TRAP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HSP75, HSP 75, HSP90L, TRAP-1

UniProt

Q12931

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRAP1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_057376

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACBD7 Conjugated Antibody
C45746 100 µL

ACBD7 Conjugated Antibody

Sign In for Pricing
View Details
Human Macrophage Scavenger Receptor 1 (MSR1) CLIA Kit
EKN50886 96 Tests

Human Macrophage Scavenger Receptor 1 (MSR1) CLIA Kit

Sign In for Pricing
View Details
Ribosomal Protein L26 Antibody [L15C18]
C21482-50uL 50 μL

Ribosomal Protein L26 Antibody [L15C18]

Sign In for Pricing
View Details
HACE1 (E3 Ubiquitin-protein Ligase HACE1, HECT Domain and Ankyrin Repeat-containing E3 Ubiquitin-protein Ligase 1, KIAA1320) (Biotin)
MBS6142219-01 0.1 mL

HACE1 (E3 Ubiquitin-protein Ligase HACE1, HECT Domain and Ankyrin Repeat-containing E3 Ubiquitin-protein Ligase 1, KIAA1320) (Biotin)

Sign In for Pricing
View Details
HACE1 (E3 Ubiquitin-protein Ligase HACE1, HECT Domain and Ankyrin Repeat-containing E3 Ubiquitin-protein Ligase 1, KIAA1320) (Biotin)
MBS6142219-02 5x 0.1 mL

HACE1 (E3 Ubiquitin-protein Ligase HACE1, HECT Domain and Ankyrin Repeat-containing E3 Ubiquitin-protein Ligase 1, KIAA1320) (Biotin)

Sign In for Pricing
View Details
Recombinant human HLA-DRA protein
ATGP2587-020 20 µg

Recombinant human HLA-DRA protein

Sign In for Pricing
View Details