Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAP1 Rabbit Polyclonal Antibody (HRP)

TRAP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HSP75, HSP 75, HSP90L, TRAP-1

UniProt

Q12931

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRAP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_057376

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMO2 (LIM Domain only 2 (rhombotin-like 1), RBTN2, RBTNL1, RHOM2, TTG2) (APC) discontinued
248225-APC 100 µL

LMO2 (LIM Domain only 2 (rhombotin-like 1), RBTN2, RBTNL1, RHOM2, TTG2) (APC) discontinued

Sign In for Pricing
View Details
Recombinant Mouse Desmoglein-3 (Dsg3), partial
orb1650374-01 20 µg

Recombinant Mouse Desmoglein-3 (Dsg3), partial

Sign In for Pricing
View Details
Recombinant Mouse Desmoglein-3 (Dsg3), partial
orb1650374-02 100 µg

Recombinant Mouse Desmoglein-3 (Dsg3), partial

Sign In for Pricing
View Details
Recombinant Mouse Desmoglein-3 (Dsg3), partial
orb1650374-03 1 mg

Recombinant Mouse Desmoglein-3 (Dsg3), partial

Sign In for Pricing
View Details
Human Antigen-presenting glycoprotein CD1d (CD1D) ELISA kit
CSB-EL004892HU-01 24 Well

Human Antigen-presenting glycoprotein CD1d (CD1D) ELISA kit

Sign In for Pricing
View Details
Human Antigen-presenting glycoprotein CD1d (CD1D) ELISA kit
CSB-EL004892HU-02 96 Well

Human Antigen-presenting glycoprotein CD1d (CD1D) ELISA kit

Sign In for Pricing
View Details