Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP90AA1 Rabbit Polyclonal Antibody (HRP)

HSP90AA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EL52, HSPN, LAP2, HSP86, HSPC1, HSPCA, Hsp89, Hsp90, LAP-2, HSP89A, HSP90A, HSP90N, Hsp103, HSPCAL1, HSPCAL4, HEL-S-65p

UniProt

P07900

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HSP90AA1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HLYKDLQPFILLRLLMPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIIN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_001017963

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGSF8 CRISPR Activation Plasmid (m2)
sc-431225-ACT-2 20 µg

IGSF8 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
BCL2L1 Knockout THP-1 Polyclonal Cells
ARG23463 1 Million

BCL2L1 Knockout THP-1 Polyclonal Cells

Sign In for Pricing
View Details
Human LATS2 Knockout HEK293T cell line
GTR15413295 1 Vial

Human LATS2 Knockout HEK293T cell line

Sign In for Pricing
View Details
Lentiviral mouse Edaradd shRNA (UAS) - Lentiviral mouse Edaradd shRNA (UAS, iRFP) (25)
GTR15257126 1 Vial

Lentiviral mouse Edaradd shRNA (UAS) - Lentiviral mouse Edaradd shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Rat Cartilage Oligomeric Matrix Protein (COMP) Antibody Pair Kit (with Standard)
MBS2100022-01 5x 96 Tests

Rat Cartilage Oligomeric Matrix Protein (COMP) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Cartilage Oligomeric Matrix Protein (COMP) Antibody Pair Kit (with Standard)
MBS2100022-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rat Cartilage Oligomeric Matrix Protein (COMP) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details