Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKN2C Rabbit Polyclonal Antibody (FITC)

CDKN2C Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P18, INK4C, p18-INK4C

UniProt

P42773

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence VMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQ

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC

NCBI Accession Number

NP_001253

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISRIB (trans-isomer)
S7400-100mg 100 mg

ISRIB (trans-isomer)

Sign In for Pricing
View Details
Human Protein S100-A2, S100A2 ELISA Kit
MBS938477-01 24 Well (LIMIT 1)

Human Protein S100-A2, S100A2 ELISA Kit

Sign In for Pricing
View Details
Human Protein S100-A2, S100A2 ELISA Kit
MBS938477-02 48 Well

Human Protein S100-A2, S100A2 ELISA Kit

Sign In for Pricing
View Details
Human Protein S100-A2, S100A2 ELISA Kit
MBS938477-03 96 Well

Human Protein S100-A2, S100A2 ELISA Kit

Sign In for Pricing
View Details
Human Protein S100-A2, S100A2 ELISA Kit
MBS938477-04 5x 96 Well

Human Protein S100-A2, S100A2 ELISA Kit

Sign In for Pricing
View Details
Human Protein S100-A2, S100A2 ELISA Kit
MBS938477-05 10x 96 Well

Human Protein S100-A2, S100A2 ELISA Kit

Sign In for Pricing
View Details