Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdk5r1 Rabbit Polyclonal Antibody (HRP)

Cdk5r1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P2, p3, p25, p35, Cdk5r, D11Bwg0379e

UniProt

P61809

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_034001

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Corneodesmosin (CDSN) Rabbit Polyclonal Antibody
TA361975 100 µL

Corneodesmosin (CDSN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3,6-Dichlorobenzene-1,2,4-tricarboxylic acid
TRC-D073605-250MG 250 mg

3,6-Dichlorobenzene-1,2,4-tricarboxylic acid

Sign In for Pricing
View Details
Vpreb3 (NM_009514) Mouse Tagged ORF Clone
MG200620 10 µg

Vpreb3 (NM_009514) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Glutamine Synthetase (GLuL) (NM_001033056) Human Recombinant Protein
TP304039 20 µg

Glutamine Synthetase (GLuL) (NM_001033056) Human Recombinant Protein

Sign In for Pricing
View Details
MEK1 (MAP2K1) pThr292 Rabbit Polyclonal Antibody
AP02532PU-N 100 µL

MEK1 (MAP2K1) pThr292 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SUMF2 (NM_015411) Human Recombinant Protein
TP313137 20 µg

SUMF2 (NM_015411) Human Recombinant Protein

Sign In for Pricing
View Details