Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdk5r1 Rabbit Polyclonal Antibody (Biotin)

Cdk5r1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P2, p3, p25, p35, Cdk5r, D11Bwg0379e

UniProt

P61809

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_034001

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calmegin (CLGN) (NM_001130675) Human Tagged Lenti ORF Clone
RC226016L4 10 µg

Calmegin (CLGN) (NM_001130675) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Biological Microscope BMIC-601
BMIC-601 1 Unit

Biological Microscope BMIC-601

Sign In for Pricing
View Details
Human FGF basic MAb (Clone 10060)
MAB233-100 100 µg

Human FGF basic MAb (Clone 10060)

Sign In for Pricing
View Details
Chmp4b sgRNA CRISPR Lentivector (Mouse) (Target 2)
K5010703 1.0 µg DNA

Chmp4b sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Troponin I, Cardiac (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) (MaxLight 750)
MBS6257442-01 0.1 mL

Troponin I, Cardiac (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) (MaxLight 750)

Sign In for Pricing
View Details
Troponin I, Cardiac (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) (MaxLight 750)
MBS6257442-02 5x 0.1 mL

Troponin I, Cardiac (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) (MaxLight 750)

Sign In for Pricing
View Details