Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS7 Rabbit Polyclonal Antibody (HRP)

RGS7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P49802

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RGS7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_002915

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-PCDHGC5 antibody
SL11161R-01 50 µL

Rabbit Anti-PCDHGC5 antibody

Sign In for Pricing
View Details
Rabbit Anti-PCDHGC5 antibody
SL11161R-02 100 µL

Rabbit Anti-PCDHGC5 antibody

Sign In for Pricing
View Details
Lentiviral human FBXL20 sgRNA gene knockout kit - Lentiviral human FBXL20 sgRNA gene knockout kit (25)
GTR15376131 1 Vial

Lentiviral human FBXL20 sgRNA gene knockout kit - Lentiviral human FBXL20 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
QuantiChrom™ Boron Assay Kit
DBOR-100 100 Tests

QuantiChrom™ Boron Assay Kit

Sign In for Pricing
View Details
Hsc 70 (Heat shock 70kD protein 8, Heat shock cognate 71kD protein, HSC70, HSC71, HSP73, HSPA10, LAP1, LPS-Associated Protein 1)
350662 100 µg

Hsc 70 (Heat shock 70kD protein 8, Heat shock cognate 71kD protein, HSC70, HSC71, HSP73, HSPA10, LAP1, LPS-Associated Protein 1)

Sign In for Pricing
View Details
Rabbit Polyclonal CEP76 Antibody [Janelia Fluor 646]
NBP1-28749JF646 0.1 mL

Rabbit Polyclonal CEP76 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details