Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SKP2 Rabbit Polyclonal Antibody (Biotin)

SKP2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P45, FBL1, FLB1, FBXL1

UniProt

Q13309

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SKP2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TREX1 (Three Prime Repair Exonuclease 1, AGS1, AGS5, CRV, DKFZp434J0310, DRN3, HERNS) (FITC)
MBS6451787-01 0.1 mL

TREX1 (Three Prime Repair Exonuclease 1, AGS1, AGS5, CRV, DKFZp434J0310, DRN3, HERNS) (FITC)

Sign In for Pricing
View Details
TREX1 (Three Prime Repair Exonuclease 1, AGS1, AGS5, CRV, DKFZp434J0310, DRN3, HERNS) (FITC)
MBS6451787-02 5x 0.1 mL

TREX1 (Three Prime Repair Exonuclease 1, AGS1, AGS5, CRV, DKFZp434J0310, DRN3, HERNS) (FITC)

Sign In for Pricing
View Details
Lentiviral human PLP2 shRNA (UAS) - Lentiviral human PLP2 shRNA (UAS, RFP) (25)
GTR15138203 1 Vial

Lentiviral human PLP2 shRNA (UAS) - Lentiviral human PLP2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Erythropoietin (EPO)
MBS2127545-01 0.1 mL

PE Linked Monoclonal Antibody to Erythropoietin (EPO)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Erythropoietin (EPO)
MBS2127545-02 0.2 mL

PE Linked Monoclonal Antibody to Erythropoietin (EPO)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Erythropoietin (EPO)
MBS2127545-03 0.5 mL

PE Linked Monoclonal Antibody to Erythropoietin (EPO)

Sign In for Pricing
View Details