Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAF6 Rabbit Polyclonal Antibody (HRP)

TRAF6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNF85, MGC:3310

UniProt

Q9Y4K3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRAF6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004611

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Glutamate Decarboxylase 1, Brain (GAD1) ELISA Kit
MBS4517532-01 48 Tests

Rat Glutamate Decarboxylase 1, Brain (GAD1) ELISA Kit

Sign In for Pricing
View Details
Rat Glutamate Decarboxylase 1, Brain (GAD1) ELISA Kit
MBS4517532-02 96 Tests

Rat Glutamate Decarboxylase 1, Brain (GAD1) ELISA Kit

Sign In for Pricing
View Details
Rat Glutamate Decarboxylase 1, Brain (GAD1) ELISA Kit
MBS4517532-03 5x 96 Tests

Rat Glutamate Decarboxylase 1, Brain (GAD1) ELISA Kit

Sign In for Pricing
View Details
Rat Glutamate Decarboxylase 1, Brain (GAD1) ELISA Kit
MBS4517532-04 10x 96 Tests

Rat Glutamate Decarboxylase 1, Brain (GAD1) ELISA Kit

Sign In for Pricing
View Details
CXCL14/BRAK/MIP-2G Rabbit Polyclonal Antibody
orb2955812-01 50 µg

CXCL14/BRAK/MIP-2G Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CXCL14/BRAK/MIP-2G Rabbit Polyclonal Antibody
orb2955812-02 100 µg

CXCL14/BRAK/MIP-2G Rabbit Polyclonal Antibody

Sign In for Pricing
View Details