Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK4 Rabbit Polyclonal Antibody (HRP)

CDK4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CMM3, PSK-J3

UniProt

P11802

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_000066

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human NHS sgRNA gene knockout kit - Lentiviral human NHS sgRNA gene knockout kit (25)
GTR15376773 1 Vial

Lentiviral human NHS sgRNA gene knockout kit - Lentiviral human NHS sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
PPIG (Peptidylprolyl Isomerase G (cyclophilin G), CARS-Cyp, CYP, MGC133241, SRCyp) (PE)
MBS6187047-01 0.1 mL

PPIG (Peptidylprolyl Isomerase G (cyclophilin G), CARS-Cyp, CYP, MGC133241, SRCyp) (PE)

Sign In for Pricing
View Details
PPIG (Peptidylprolyl Isomerase G (cyclophilin G), CARS-Cyp, CYP, MGC133241, SRCyp) (PE)
MBS6187047-02 5x 0.1 mL

PPIG (Peptidylprolyl Isomerase G (cyclophilin G), CARS-Cyp, CYP, MGC133241, SRCyp) (PE)

Sign In for Pricing
View Details
CCNL2, ID (CCNL2, Cyclin-L2, Paneth cell-enhanced expression protein) (MaxLight 490) discontinued
033420-ML490 100 µL

CCNL2, ID (CCNL2, Cyclin-L2, Paneth cell-enhanced expression protein) (MaxLight 490) discontinued

Sign In for Pricing
View Details
ErbB 4/ERBB4 Rabbit Polyclonal Antibody (Carrier-free)
orb3119118 100 µg

ErbB 4/ERBB4 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
NONO sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1440306 1.0 µg DNA

NONO sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details