Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM5 Rabbit Polyclonal Antibody (HRP)

CEACAM5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CEA, CD66e

UniProt

P06731

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CEAM5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKE

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_004354

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GRbeta (Glucocorticoid Receptor Beta) ELISA Kit
MBS2513465-01 24 Tests (Limit 1)

Human GRbeta (Glucocorticoid Receptor Beta) ELISA Kit

Sign In for Pricing
View Details
Human GRbeta (Glucocorticoid Receptor Beta) ELISA Kit
MBS2513465-02 48 Tests

Human GRbeta (Glucocorticoid Receptor Beta) ELISA Kit

Sign In for Pricing
View Details
Human GRbeta (Glucocorticoid Receptor Beta) ELISA Kit
MBS2513465-03 96 Tests

Human GRbeta (Glucocorticoid Receptor Beta) ELISA Kit

Sign In for Pricing
View Details
Human GRbeta (Glucocorticoid Receptor Beta) ELISA Kit
MBS2513465-04 5x 96 Tests

Human GRbeta (Glucocorticoid Receptor Beta) ELISA Kit

Sign In for Pricing
View Details
Human GRbeta (Glucocorticoid Receptor Beta) ELISA Kit
MBS2513465-05 10x 96 Tests

Human GRbeta (Glucocorticoid Receptor Beta) ELISA Kit

Sign In for Pricing
View Details
Luteinizing Hormone (LH) (APC) discontinued
L7500-02H-APC 100 µL

Luteinizing Hormone (LH) (APC) discontinued

Sign In for Pricing
View Details