Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAD Rabbit Polyclonal Antibody (HRP)

BAD Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BBC2, BCL2L8

UniProt

Q92934

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human BAD

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004313

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Eosinophil-Associated Ribonuclease A Family Member 12 ELISA Kit
MBS028001-01 48 Well

Porcine Eosinophil-Associated Ribonuclease A Family Member 12 ELISA Kit

Sign In for Pricing
View Details
Porcine Eosinophil-Associated Ribonuclease A Family Member 12 ELISA Kit
MBS028001-02 96 Well

Porcine Eosinophil-Associated Ribonuclease A Family Member 12 ELISA Kit

Sign In for Pricing
View Details
Porcine Eosinophil-Associated Ribonuclease A Family Member 12 ELISA Kit
MBS028001-03 5x 96 Well

Porcine Eosinophil-Associated Ribonuclease A Family Member 12 ELISA Kit

Sign In for Pricing
View Details
Porcine Eosinophil-Associated Ribonuclease A Family Member 12 ELISA Kit
MBS028001-04 10x 96 Well

Porcine Eosinophil-Associated Ribonuclease A Family Member 12 ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Human AQP1 Polyclonal Antibody
PA89447HU-01 50 µg

Rabbit Anti-Human AQP1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human AQP1 Polyclonal Antibody
PA89447HU-02 100 µg

Rabbit Anti-Human AQP1 Polyclonal Antibody

Sign In for Pricing
View Details