Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK2 Rabbit Polyclonal Antibody (FITC)

CDK2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CDKN2, p33 (CDK2)

UniProt

P24941

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPE

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001789

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc4a2 Mouse siRNA Oligo Duplex (Locus ID 20535)
SR427757 1 Kit

Slc4a2 Mouse siRNA Oligo Duplex (Locus ID 20535)

Sign In for Pricing
View Details
Anti-UBE2I/UBC9 Polyclonal Antibody
HX847014-01 50 µg

Anti-UBE2I/UBC9 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-UBE2I/UBC9 Polyclonal Antibody
HX847014-02 100 µg

Anti-UBE2I/UBC9 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Palmitoyltransferase PFA4 (PFA4)
MBS7026039-01 0.02 mg

Recombinant Cryptococcus neoformans var. neoformans serotype D Palmitoyltransferase PFA4 (PFA4)

Sign In for Pricing
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Palmitoyltransferase PFA4 (PFA4)
MBS7026039-02 0.1 mg

Recombinant Cryptococcus neoformans var. neoformans serotype D Palmitoyltransferase PFA4 (PFA4)

Sign In for Pricing
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Palmitoyltransferase PFA4 (PFA4)
MBS7026039-03 5x 0.1 mg

Recombinant Cryptococcus neoformans var. neoformans serotype D Palmitoyltransferase PFA4 (PFA4)

Sign In for Pricing
View Details