Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK2 Rabbit Polyclonal Antibody (FITC)

CDK2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CDKN2, p33 (CDK2)

UniProt

P24941

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPE

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001789

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFF2 (Trefoil Factor 2, SP, Spasmolysin, Spasmolytic Polypeptide, SML1)
336945-01 50 µL

TFF2 (Trefoil Factor 2, SP, Spasmolysin, Spasmolytic Polypeptide, SML1)

Sign In for Pricing
View Details
TFF2 (Trefoil Factor 2, SP, Spasmolysin, Spasmolytic Polypeptide, SML1)
336945-02 100 µL

TFF2 (Trefoil Factor 2, SP, Spasmolysin, Spasmolytic Polypeptide, SML1)

Sign In for Pricing
View Details
Canine Leukotriene D4 ELISA kit
GTR10439345 96 Well

Canine Leukotriene D4 ELISA kit

Sign In for Pricing
View Details
TBPL1 Rabbit pAb
E45R27512N-50 50 µL

TBPL1 Rabbit pAb

Sign In for Pricing
View Details
TRNAN11 CRISPR Knock Out 293T Cell Line (Human)
48217141 1x 10^6 Cells / 1.0 mL

TRNAN11 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Lentiviral human GJE1 sgRNA gene knockout kit - Lentiviral human GJE1 sgRNA gene knockout kit (100)
GTR15378634 1 Vial

Lentiviral human GJE1 sgRNA gene knockout kit - Lentiviral human GJE1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details