Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK2 Rabbit Polyclonal Antibody (HRP)

CDK2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CDKN2, p33 (CDK2)

UniProt

P24941

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPE

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001789

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR11H2 (NM_001197287) Human Tagged ORF Clone Lentiviral Particle
RC230804L3V 200 µL

OR11H2 (NM_001197287) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral mouse Utp15 shRNA (UAS) - Lentiviral mouse Utp15 shRNA (UAS, RFP) (25)
GTR15200291 1 Vial

Lentiviral mouse Utp15 shRNA (UAS) - Lentiviral mouse Utp15 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
C19orf77 Rabbit Polyclonal Antibody (Cy5)
orb938405 100 µL

C19orf77 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Uchl1 Rat shRNA Lentiviral Particle (Locus ID 29545)
TL710038V 500 µL Each

Uchl1 Rat shRNA Lentiviral Particle (Locus ID 29545)

Sign In for Pricing
View Details
RBBP5 Antibody (OABF01634-100UL)
OABF01634-100UL 100 µL

RBBP5 Antibody (OABF01634-100UL)

Sign In for Pricing
View Details
FOXE3 Antibody
E38PA4976 100 µL

FOXE3 Antibody

Sign In for Pricing
View Details