Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHEK1 Rabbit Polyclonal Antibody (HRP)

CHEK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CHK1

UniProt

O14757

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CHEK1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCP

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001107593

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Csrnp2, NT (Csrnp2, Fam130a1, Taip12, Cysteine/serine-rich nuclear protein 2, Protein FAM130A1, TGF-beta-induced apoptosis protein 12) (APC)
MBS6289441-01 0.2 mL

Csrnp2, NT (Csrnp2, Fam130a1, Taip12, Cysteine/serine-rich nuclear protein 2, Protein FAM130A1, TGF-beta-induced apoptosis protein 12) (APC)

Sign In for Pricing
View Details
Csrnp2, NT (Csrnp2, Fam130a1, Taip12, Cysteine/serine-rich nuclear protein 2, Protein FAM130A1, TGF-beta-induced apoptosis protein 12) (APC)
MBS6289441-02 5x 0.2 mL

Csrnp2, NT (Csrnp2, Fam130a1, Taip12, Cysteine/serine-rich nuclear protein 2, Protein FAM130A1, TGF-beta-induced apoptosis protein 12) (APC)

Sign In for Pricing
View Details
HIV-1 vif/HIV Rabbit Polyclonal Antibody (Fluoro594)
orb3086972 200 µL

HIV-1 vif/HIV Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
TF2H1 Antibody
MBS8587330-01 0.1 mg

TF2H1 Antibody

Sign In for Pricing
View Details
TF2H1 Antibody
MBS8587330-02 0.1 mL (AF405L)

TF2H1 Antibody

Sign In for Pricing
View Details
TF2H1 Antibody
MBS8587330-03 0.1 mL (AF405S)

TF2H1 Antibody

Sign In for Pricing
View Details