Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS4 Rabbit Polyclonal Antibody (HRP)

RGS4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGP4, SCZD9

UniProt

A7XA59

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001095915

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Sepiapterin reductase, Spr ELISA KIT
ELI-18741m 96 Tests

Mouse Sepiapterin reductase, Spr ELISA KIT

Sign In for Pricing
View Details
T-Cell Surface Glycoprotein CD8 Beta Chain (CD8B) Antibody
abx028037-01 80 µL

T-Cell Surface Glycoprotein CD8 Beta Chain (CD8B) Antibody

Sign In for Pricing
View Details
T-Cell Surface Glycoprotein CD8 Beta Chain (CD8B) Antibody
abx028037-02 400 µL

T-Cell Surface Glycoprotein CD8 Beta Chain (CD8B) Antibody

Sign In for Pricing
View Details
Tumor Necrosis Factor Ligand Superfamily Member 11 / RANKL (TNFSF11) Antibody
abx270109-01 50 Tests

Tumor Necrosis Factor Ligand Superfamily Member 11 / RANKL (TNFSF11) Antibody

Sign In for Pricing
View Details
Tumor Necrosis Factor Ligand Superfamily Member 11 / RANKL (TNFSF11) Antibody
abx270109-02 100 Tests

Tumor Necrosis Factor Ligand Superfamily Member 11 / RANKL (TNFSF11) Antibody

Sign In for Pricing
View Details
Tumor Necrosis Factor Ligand Superfamily Member 11 / RANKL (TNFSF11) Antibody
abx270109-03 200 Tests

Tumor Necrosis Factor Ligand Superfamily Member 11 / RANKL (TNFSF11) Antibody

Sign In for Pricing
View Details