Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAF6 Rabbit Polyclonal Antibody (FITC)

TRAF6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RNF85, MGC:3310

UniProt

Q9Y4K3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRAF6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDA

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004611

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNRC4, NT (CELF3, BRUNOL1, CAGH4, ERDA4, TNRC4, CUGBP Elav-like family member 3, Bruno-like protein 1, CAG repeat protein 4, CUG-BP- and ETR-3-like factor 3, ELAV-type RNA-binding protein 1, Expanded repeat domain protein CAG/CTG 4, RNA-binding protein BRUNOL-1, Trinucleotide repeat-containing gene 4 protein) (AP) discontinued
043114-AP 200 µL

TNRC4, NT (CELF3, BRUNOL1, CAGH4, ERDA4, TNRC4, CUGBP Elav-like family member 3, Bruno-like protein 1, CAG repeat protein 4, CUG-BP- and ETR-3-like factor 3, ELAV-type RNA-binding protein 1, Expanded repeat domain protein CAG/CTG 4, RNA-binding protein BRUNOL-1, Trinucleotide repeat-containing gene 4 protein) (AP) discontinued

Sign In for Pricing
View Details
CATSPER2 (Cation Channel Sperm-associated Protein 2, CatSper2) (APC)
137609-APC 100 µL

CATSPER2 (Cation Channel Sperm-associated Protein 2, CatSper2) (APC)

Sign In for Pricing
View Details
Drosha Antibody, mAb, Rabbit
A03680-50 50 µL

Drosha Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Anti-UBE1C/UBA3 Antibody Picoband® (Cy3 Conjugate)
PB9838-Cy3 100 µg/Vial

Anti-UBE1C/UBA3 Antibody Picoband® (Cy3 Conjugate)

Sign In for Pricing
View Details
GENLISA Mouse Glucocorticoid Receptor Β ELISA
KLM3595 1x 96 Well

GENLISA Mouse Glucocorticoid Receptor Β ELISA

Sign In for Pricing
View Details
PLV2-U6-MYOF-shRNA2-Puro Plasmid
PVT70234 2 µg

PLV2-U6-MYOF-shRNA2-Puro Plasmid

Sign In for Pricing
View Details