Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAF6 Rabbit Polyclonal Antibody (FITC)

TRAF6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RNF85, MGC:3310

UniProt

Q9Y4K3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRAF6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDA

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004611

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR37L1, NT (GPR37L1, ETBRLP2, Endothelin B receptor-like protein 2, G-protein coupled receptor 37-like 1) (PE) discontinued
036242-PE 200 µL

GPR37L1, NT (GPR37L1, ETBRLP2, Endothelin B receptor-like protein 2, G-protein coupled receptor 37-like 1) (PE) discontinued

Sign In for Pricing
View Details
Human Galanin peptides ELISA Kit
MBS761584-01 48 Well

Human Galanin peptides ELISA Kit

Sign In for Pricing
View Details
Human Galanin peptides ELISA Kit
MBS761584-02 96 Well

Human Galanin peptides ELISA Kit

Sign In for Pricing
View Details
Human Galanin peptides ELISA Kit
MBS761584-03 5x 96 Well

Human Galanin peptides ELISA Kit

Sign In for Pricing
View Details
Human Galanin peptides ELISA Kit
MBS761584-04 10x 96 Well

Human Galanin peptides ELISA Kit

Sign In for Pricing
View Details
Beta-2 microglobulin Antibody, Rabbit PAb, Antigen Affinity Purified
MBS8124370-01 0.1 mL

Beta-2 microglobulin Antibody, Rabbit PAb, Antigen Affinity Purified

Sign In for Pricing
View Details