Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NBN Rabbit Polyclonal Antibody (FITC)

NBN Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ATV, NBS, P95, NBS1, AT-V1, AT-V2

UniProt

O60934

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human NBN

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TGLKTTTPGPSLSQGVSVDEKLMPSAPVNTTTYVADTESEQADTWDLSER

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Mouse CD40 Antibody[FGK4.5/FGK45]
E-AB-F1028UE-01 25 µg

APC Anti-Mouse CD40 Antibody[FGK4.5/FGK45]

Sign In for Pricing
View Details
APC Anti-Mouse CD40 Antibody[FGK4.5/FGK45]
E-AB-F1028UE-02 100 µg

APC Anti-Mouse CD40 Antibody[FGK4.5/FGK45]

Sign In for Pricing
View Details
Human ICOS Ligand/B7-H2/ICOSLG, C-His Tag (ECD)
HA210593-01 20 µg

Human ICOS Ligand/B7-H2/ICOSLG, C-His Tag (ECD)

Sign In for Pricing
View Details
Human ICOS Ligand/B7-H2/ICOSLG, C-His Tag (ECD)
HA210593-02 50 µg

Human ICOS Ligand/B7-H2/ICOSLG, C-His Tag (ECD)

Sign In for Pricing
View Details
Human ICOS Ligand/B7-H2/ICOSLG, C-His Tag (ECD)
HA210593-03 100 µg

Human ICOS Ligand/B7-H2/ICOSLG, C-His Tag (ECD)

Sign In for Pricing
View Details
SERPINB4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C8]
TA502386BM 100 µL

SERPINB4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C8]

Sign In for Pricing
View Details