Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NBN Rabbit Polyclonal Antibody (FITC)

NBN Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ATV, NBS, P95, NBS1, AT-V1, AT-V2

UniProt

O60934

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human NBN

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TGLKTTTPGPSLSQGVSVDEKLMPSAPVNTTTYVADTESEQADTWDLSER

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHOG Antibody
8C18414-AAT 50 µg

RHOG Antibody

Sign In for Pricing
View Details
FBXO45 Rabbit Polyclonal Antibody
TA372555 100 µL

FBXO45 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Amino-2-nitrobenzoic Acid
TRC-A618395-25G 25 g

5-Amino-2-nitrobenzoic Acid

Sign In for Pricing
View Details
HRP Conjugated Arum maculatum Lectin (Lords and Ladies) -AMA-
H-8012-1 1 mg

HRP Conjugated Arum maculatum Lectin (Lords and Ladies) -AMA-

Sign In for Pricing
View Details
Mouse Pro-MMP-9 (Pro-Matrix Metalloproteinase-9) ELISA Kit
E-EL-M3066-01 24 Tests

Mouse Pro-MMP-9 (Pro-Matrix Metalloproteinase-9) ELISA Kit

Sign In for Pricing
View Details
Mouse Pro-MMP-9 (Pro-Matrix Metalloproteinase-9) ELISA Kit
E-EL-M3066-02 48 Tests

Mouse Pro-MMP-9 (Pro-Matrix Metalloproteinase-9) ELISA Kit

Sign In for Pricing
View Details