Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PXN Rabbit Polyclonal Antibody (HRP)

PXN Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P49023

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PXN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VGEEEHVYSFPNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPP

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp609 Mouse Gene Knockout Kit (CRISPR)
KN519904 1 Kit

Zfp609 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon: right
CB620986 1 Block

Frozen Tissue Blocks, Colon: right

Sign In for Pricing
View Details
Anti-DYKDDDDK Tag Antibody
KC-17397-01 50 μL

Anti-DYKDDDDK Tag Antibody

Sign In for Pricing
View Details
Anti-DYKDDDDK Tag Antibody
KC-17397-02 100 µL

Anti-DYKDDDDK Tag Antibody

Sign In for Pricing
View Details
Anti-DYKDDDDK Tag Antibody
KC-17397-03 1 mL

Anti-DYKDDDDK Tag Antibody

Sign In for Pricing
View Details
(R)-5-Bromo-3-(1-(2,6-dichloro-3-fluorophenyl)ethoxy)pyridin-2-amine
TRC-B678833-250MG 250 mg

(R)-5-Bromo-3-(1-(2,6-dichloro-3-fluorophenyl)ethoxy)pyridin-2-amine

Sign In for Pricing
View Details