Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PXN Rabbit Polyclonal Antibody (Biotin)

PXN Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

P49023

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PXN

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VGEEEHVYSFPNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPP

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTX3 Human shRNA Plasmid Kit (Locus ID 345778)
TR318382 1 Kit

MTX3 Human shRNA Plasmid Kit (Locus ID 345778)

Sign In for Pricing
View Details
PRRT1 ORF Vector (Human) (pORF)
37820011 1.0 µg DNA

PRRT1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Olr321 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7313102 1.0 µg DNA

Olr321 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
SMYD3 Rabbit mAb
RDSA67549 100 µL

SMYD3 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Rat PDGF-BB
BL10014_R 0.05 mg

Recombinant Rat PDGF-BB

Sign In for Pricing
View Details
Set sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6753706 1.0 µg DNA

Set sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details