Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ILK Rabbit Polyclonal Antibody (FITC)

ILK Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P59, ILK-1, ILK-2, p59ILK, HEL-S-28

UniProt

Q13418

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ILK

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004508

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTP rho (PTPRT) Human Gene Knockout Kit (CRISPR)
KN213847 1 Kit

PTP rho (PTPRT) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), 0.2mg/mL
BNUB1540-100 1x 100 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), 0.2mg/mL

Sign In for Pricing
View Details
(4-Nitrophenyl)acetic Acid
TRC-N497025-5G 5 g

(4-Nitrophenyl)acetic Acid

Sign In for Pricing
View Details
EIF2AK1 Human Gene Knockout Kit (CRISPR)
KN200065BN 1 Kit

EIF2AK1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Thumpd3 Mouse Gene Knockout Kit (CRISPR)
KN517550 1 Kit

Thumpd3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF647 conjugate, 0.1mg/mL
BNC472076-500 1x 500 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details