Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bcl2l2 Rabbit Polyclonal Antibody (HRP)

Bcl2l2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Bcl, c98, Bcl-, Gtrg, Gtro, bclw, Bcl-w, Gtrgal2, AW048834, Gtrosa41

UniProt

P70345

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Bcl2l2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_031563

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC2 Antibody
MBS9520362-01 0.04 mL

LRRC2 Antibody

Sign In for Pricing
View Details
LRRC2 Antibody
MBS9520362-02 0.1 mL

LRRC2 Antibody

Sign In for Pricing
View Details
LRRC2 Antibody
MBS9520362-03 0.2 mL

LRRC2 Antibody

Sign In for Pricing
View Details
LRRC2 Antibody
MBS9520362-04 5x 0.2 mL

LRRC2 Antibody

Sign In for Pricing
View Details
Human SLC19A2 Pre-designed siRNA Set A
SI014903A 1 Each

Human SLC19A2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rat Hepatoma-derived growth factor, HDGF ELISA Kit
MBS1611647-01 48 Well

Rat Hepatoma-derived growth factor, HDGF ELISA Kit

Sign In for Pricing
View Details