Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf28 Rabbit Polyclonal Antibody (FITC)

C2orf28 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P18, APR3, APR-3, APR--3, PRO240, C2orf28, HSPC013

UniProt

Q6UW56

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf28

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057169

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKACA Human Knockdown Lysate
LY300491 100 µg

PRKACA Human Knockdown Lysate

Sign In for Pricing
View Details
ARMET (MANF) Mouse Monoclonal Antibody [Clone ID: 1G12]
AM33442PU-N 100 µg

ARMET (MANF) Mouse Monoclonal Antibody [Clone ID: 1G12]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Thyroid gland
CB610034 1 Block

Frozen Tissue Blocks, Thyroid gland

Sign In for Pricing
View Details
HRP Goat Anti-Digoxigenin/Digoxin (DIG), 1 mg/mL
#20864-100uL 1x 100 µL

HRP Goat Anti-Digoxigenin/Digoxin (DIG), 1 mg/mL

Sign In for Pricing
View Details
CHL1 Rabbit Polyclonal Antibody
TA374743 100 µL

CHL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker), CF647 conjugate, 0.1mg/mL
BNC471774-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details