Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf28 Rabbit Polyclonal Antibody (HRP)

C2orf28 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P18, APR3, APR-3, APR--3, PRO240, C2orf28, HSPC013

UniProt

Q6UW56

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf28

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057169

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCG-beta (HCGb/54), CF640R conjugate, 0.1mg/mL
BNC400054-500 1x 500 µL

HCG-beta (HCGb/54), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAT1 (FAT atypical cadherin 1) (FAT1-3D7/1), 0.2mg/mL
BNUB2322-500 1x 500 µL

FAT1 (FAT atypical cadherin 1) (FAT1-3D7/1), 0.2mg/mL

Sign In for Pricing
View Details
HPV-16 (Human Papilloma Virus 16) (HPV16/2058R), 0.2mg/mL
BNUB2058-500 1x 500 µL

HPV-16 (Human Papilloma Virus 16) (HPV16/2058R), 0.2mg/mL

Sign In for Pricing
View Details
KDELR2 (C-term) Rabbit Polyclonal Antibody
AP52327PU-N 400 µL

KDELR2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SMARCD2 (NM_001098426) Human Over-expression Lysate
LY420583 100 µg

SMARCD2 (NM_001098426) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR566348 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details