Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf28 Rabbit Polyclonal Antibody (HRP)

C2orf28 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P18, APR3, APR-3, APR--3, PRO240, C2orf28, HSPC013

UniProt

Q6UW56

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf28

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057169

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Lung
CB502726 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Recombinant Scramblase 1 Antibody
RC-16071-01 50 μL

Recombinant Scramblase 1 Antibody

Sign In for Pricing
View Details
Recombinant Scramblase 1 Antibody
RC-16071-02 100 µL

Recombinant Scramblase 1 Antibody

Sign In for Pricing
View Details
Recombinant Scramblase 1 Antibody
RC-16071-03 1 mL

Recombinant Scramblase 1 Antibody

Sign In for Pricing
View Details
Multiallergy Food
AL0105 4x 2.5 mL

Multiallergy Food

Sign In for Pricing
View Details
ANKRD5 (ANKEF1) (C-term) Rabbit Polyclonal Antibody
AP50188PU-N 400 µL

ANKRD5 (ANKEF1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details