Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLR2 Rabbit Polyclonal Antibody (HRP)

TLR2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TIL4, CD282

UniProt

O60603

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TLR2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003255

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD54 (RAD54L) Human Gene Knockout Kit (CRISPR)
KN220046BN 1 Kit

RAD54 (RAD54L) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Optional generator 14mm x 130mm saw tooth, for 50ml tubes up to 250ml vessels
D1000-M14 1 Each

Optional generator 14mm x 130mm saw tooth, for 50ml tubes up to 250ml vessels

Sign In for Pricing
View Details
FG 2216
TRC-F329000-5MG 5 mg

FG 2216

Sign In for Pricing
View Details
Phospho-PI3K p85 (Y467) + PI3K p55 (Y199) Recombinant Rabbit monoclonal Antibody
HA750717 100 µL

Phospho-PI3K p85 (Y467) + PI3K p55 (Y199) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human ALKBH4 activation kit by CRISPRa
GA110259 1 Kit

Human ALKBH4 activation kit by CRISPRa

Sign In for Pricing
View Details
MAP4K4 Mouse Monoclonal Antibody [Clone ID: 4H9E7]
AM06248SU-N 100 µL

MAP4K4 Mouse Monoclonal Antibody [Clone ID: 4H9E7]

Sign In for Pricing
View Details