Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hand2 Rabbit Polyclonal Antibody (FITC)

Hand2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Hed, Th2, dHA, Ehan, Thin, bHLHa, dHAND, Ehand2, Thing2, bHLHa26, AI225906, AI661148

UniProt

Q61039

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQ

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034532

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9 ORF Vector (Rat) (pORF)
14764016 1.0 µg DNA

C9 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Recombinant Shewanella amazonensis Membrane protein insertase YidC (yidC)
MBS7034834-01 0.02 mg

Recombinant Shewanella amazonensis Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Recombinant Shewanella amazonensis Membrane protein insertase YidC (yidC)
MBS7034834-02 0.1 mg

Recombinant Shewanella amazonensis Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Recombinant Shewanella amazonensis Membrane protein insertase YidC (yidC)
MBS7034834-03 5x 0.1 mg

Recombinant Shewanella amazonensis Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
CIRBP Rabbit Polyclonal Antibody (PE-Cy7)
orb884760 100 µL

CIRBP Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
FBXL11 Peptide - N-terminal region
orb2021080 100 µg

FBXL11 Peptide - N-terminal region

Sign In for Pricing
View Details