Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hand2 Rabbit Polyclonal Antibody (Biotin)

Hand2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Hed, Th2, dHA, Ehan, Thin, bHLHa, dHAND, Ehand2, Thing2, bHLHa26, AI225906, AI661148

UniProt

Q61039

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQ

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034532

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HA/Hemagglutinin, H3N2 (ACS71642, HEK293, His)
HY-P75105 1 Each

HA/Hemagglutinin, H3N2 (ACS71642, HEK293, His)

Sign In for Pricing
View Details
TNFRSF25 Protein Vector (Rat) (pPB-C-His)
PV312098 500 ng

TNFRSF25 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
LINGO, phosphorylated (1, phosphorylated (pS596) (LRRN6A, Lingo1, Lern1, Lrrn6a, Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1, Leucine-rich repeat neuronal protein 1, Leucine-rich repeat neuronal protein 6A) (MaxLight 405) discontinued
037807-ML405 100 µL

LINGO, phosphorylated (1, phosphorylated (pS596) (LRRN6A, Lingo1, Lern1, Lrrn6a, Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1, Leucine-rich repeat neuronal protein 1, Leucine-rich repeat neuronal protein 6A) (MaxLight 405) discontinued

Sign In for Pricing
View Details
SENP8 ORF Vector (Human) (pORF)
ORF009341 1.0 µg DNA

SENP8 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Bordetella petrii Recombination protein RecR (recR)
MBS1250147-01 0.02 mg (E-Coli)

Recombinant Bordetella petrii Recombination protein RecR (recR)

Sign In for Pricing
View Details
Recombinant Bordetella petrii Recombination protein RecR (recR)
MBS1250147-02 0.1 mg (E-Coli)

Recombinant Bordetella petrii Recombination protein RecR (recR)

Sign In for Pricing
View Details