Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIF1A Rabbit Polyclonal Antibody (HRP)

HIF1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HIF1, MOP1, PASD8, HIF-1A, bHLHe78, HIF-1alpha, HIF1-ALPHA, HIF-1-alpha

UniProt

Q16665

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HIF1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVS

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_851397

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX27 (Center) Rabbit Polyclonal Antibody
AP53977PU-N 400 µL

SNX27 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF568 conjugate, 0.1mg/mL
BNC682085-500 1x 500 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human BK (Bradykinin) ELISA Kit
E-EL-H6211-01 24 Tests

Human BK (Bradykinin) ELISA Kit

Sign In for Pricing
View Details
Human BK (Bradykinin) ELISA Kit
E-EL-H6211-02 48 Tests

Human BK (Bradykinin) ELISA Kit

Sign In for Pricing
View Details
Human BK (Bradykinin) ELISA Kit
E-EL-H6211-03 96 Tests

Human BK (Bradykinin) ELISA Kit

Sign In for Pricing
View Details
GSK3 alpha (GSK3A) pSer21 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 9B8]
AM00065PU-N 100 µg

GSK3 alpha (GSK3A) pSer21 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 9B8]

Sign In for Pricing
View Details