Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIF1A Rabbit Polyclonal Antibody (Biotin)

HIF1A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HIF1, MOP1, PASD8, HIF-1A, bHLHe78, HIF-1alpha, HIF1-ALPHA, HIF-1-alpha

UniProt

Q16665

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HIF1A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVS

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_851397

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFAND6 Protein (N-His, Human)
P509845 100 µg

ZFAND6 Protein (N-His, Human)

Sign In for Pricing
View Details
UBE2D3P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV788956 1.0 µg DNA

UBE2D3P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Platelet Derived Growth Factor BB (PDGFBB)
MBS2045295-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Platelet Derived Growth Factor BB (PDGFBB)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Platelet Derived Growth Factor BB (PDGFBB)
MBS2045295-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Platelet Derived Growth Factor BB (PDGFBB)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Platelet Derived Growth Factor BB (PDGFBB)
MBS2045295-03 0.5 mL

Cy3-Linked Monoclonal Antibody to Platelet Derived Growth Factor BB (PDGFBB)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Platelet Derived Growth Factor BB (PDGFBB)
MBS2045295-04 1 mL

Cy3-Linked Monoclonal Antibody to Platelet Derived Growth Factor BB (PDGFBB)

Sign In for Pricing
View Details