Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TP53INP1 Rabbit Polyclonal Antibody (Biotin)

TP53INP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SIP, Teap, p53DINP1, TP53DINP1, TP53INP1A, TP53INP1B

UniProt

Q96A56

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TP53INP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_150601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Prmt3 shRNA (UAS) - Lentiviral mouse Prmt3 shRNA (UAS, RFP) plasmid
GTR15238729 1 Vial

Lentiviral mouse Prmt3 shRNA (UAS) - Lentiviral mouse Prmt3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rabbit LAP2 beta gamma/TMPO Antibody
orb1522209-01 10 µL

Rabbit LAP2 beta gamma/TMPO Antibody

Sign In for Pricing
View Details
Rabbit LAP2 beta gamma/TMPO Antibody
orb1522209-02 100 µL

Rabbit LAP2 beta gamma/TMPO Antibody

Sign In for Pricing
View Details
Recombinant Mouse Tumor Necrosis factor Ligand Superfamily Member 8 (TNFSF8), C-His
AP2C881-01 1 mg

Recombinant Mouse Tumor Necrosis factor Ligand Superfamily Member 8 (TNFSF8), C-His

Sign In for Pricing
View Details
Recombinant Mouse Tumor Necrosis factor Ligand Superfamily Member 8 (TNFSF8), C-His
AP2C881-02 10 µg

Recombinant Mouse Tumor Necrosis factor Ligand Superfamily Member 8 (TNFSF8), C-His

Sign In for Pricing
View Details
Recombinant Mouse Tumor Necrosis factor Ligand Superfamily Member 8 (TNFSF8), C-His
AP2C881-03 50 µg

Recombinant Mouse Tumor Necrosis factor Ligand Superfamily Member 8 (TNFSF8), C-His

Sign In for Pricing
View Details